PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS61290.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family ZF-HD
Protein Properties Length: 208aa    MW: 22750.7 Da    PI: 9.6231
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS61290.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer101.36.8e-32762359
  ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59
                 +++YkeClkNhAa++Gg+++DGCgEfmps ge+gt++alkCaAC CHRnFHR+e++ 
   EPS61290.1  7 RIVYKECLKNHAAKIGGNVTDGCGEFMPS-GEDGTIEALKCAACSCHRNFHRKEHHG 62
                 689*************************9.999********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047704.2E-29860IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257747.0E-24869IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.6E-301059IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.1881059IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466891.33E-19114186IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-30120186IPR009057Homeodomain-like
TIGRFAMsTIGR015651.9E-29125181IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
GVVGTGRIVY KECLKNHAAK IGGNVTDGCG EFMPSGEDGT IEALKCAACS CHRNFHRKEH  60
HGEAAGTAMV HPLQHRVVGG HWTSAMVQPV KMAFGGNAGT DSSSEELNFN PYHSGGGIPR  120
PSSTKKRFRT KFTADQKERM LEFAEKLGWR IPREDDSEIQ RFCAEVGVKR QVFKVWMHNN  180
KSASKKITIT PQTQHQHQVR GGGGGGPD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A9e-261241831675ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011083674.11e-92PREDICTED: zinc-finger homeodomain protein 5
SwissprotQ9M9S01e-64ZHD4_ARATH; Zinc-finger homeodomain protein 4
TrEMBLS8C3821e-156S8C382_9LAMI; Uncharacterized protein (Fragment)
STRINGPGSC0003DMT4000095816e-75(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.22e-65homeobox protein 31
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]